The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the epsin N-terminal homology (ENTH) domain of human epsin. J.STRUCT.FUNCT.GENOM. 2 1-8 2001
    Site RSGI
    PDB Id 1inz Target Id nhs001016601.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13756, Molecular Weight 16893.38 Da.
    Residues 144 Isoelectric Point 8.64
    Sequence mstsslrrqmknivhnyseaeikvreatsndpwgpssslmseiadltynvvafseimsmiwkrlndhgk nwrhvykamtlmeyliktgservsqqckenmyavqtlkdfqyvdrdgkdqgvnvrekakqlvallrded rlreer
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch