.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iom

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of citrate synthase from Thermus thermophilus HB8 at 1.5 angstrom resolution. To be Published
    Site RSGI
    PDB Id 1iom Target Id ttk003000536.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14406, Molecular Weight 42302.21 Da.
    Residues 377 Isoelectric Point 6.18
    Sequence mevarglegvlftesrmcyidgqqgklyyygipiqelaekssfeettflllhgrlprrqeleefsaala rrralpahllesfkrypvsahpmsflrtavsefgmldptegdisrealyekgldliakfativaankrl kegkepippredlshaanflymangvepspeqarlmdaalilhaehgfnastftaiaafstetdlysai taavaslkgprhgganeavmrmiqeigtperarewvreklakkerimgmghrvykafdpragvleklar lvaekhghskeyqilkiveeeagkvlnprgiypnvdfysgvvysdlgfslefftpifavarisgwvghi leyqeldnrllrpgakyvgeldvpyvpleare
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.185
    Matthews' coefficent 3.24 Rfactor 0.172
    Waters 469 Solvent Content 62.00

    Ligand Information
    Ligands SO4 (SULFATE) x 1;CO3 (CARBONATE) x 1;GOL (GLYCEROL) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch