.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ipf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Capturing Enzyme Structure Prior to Reaction Initiation: Tropinone Reductase-II-Substrate Complexes. BIOCHEMISTRY 42 5566-5573 2003
    Site RSGI
    PDB Id 1ipf Target Id my_001000042.2
    Molecular Characteristics
    Source Datura stramonium
    Alias Ids TPS13721, Molecular Weight 28178.74 Da.
    Residues 259 Isoelectric Point 5.88
    Sequence agrwnlegctalvtggsrgigygiveelaslgasvytcsrnqkelndcltqwrskgfkveasvcdlssr serqelmntvanhfhgklnilvnnagiviykeakdytvedyslimsinfeaayhlsvlahpflkaserg nvvfissvsgalavpyeavygatkgamdqltrclafewakdnirvngvgpgviatslvemtiqdpeqke nlnklidrcalrrmgepkelaamvaflcfpaasyvtgqiiyvdgglmancgf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.265
    Matthews' coefficent 3.41 Rfactor 0.197
    Waters 62 Solvent Content 63.70

    Ligand Information
    Ligands NDP (NADPH) x 2;TNE (8-METHYL-8-AZABICYCLO[3,2,1]OCTAN-3-ONE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch