.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iq3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the Eps15 homology domain of a human POB1 (partner of RalBP1). FEBS Lett. 442 138-142 1999
    Site RSGI
    PDB Id 1iq3 Target Id trt001000213.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14106, Molecular Weight 12432.17 Da.
    Residues 110 Isoelectric Point 4.45
    Sequence gslqdnssypdepwriteeqreyyvnqfrslqpdpssfisgsvaknfftksklsipelsyiwelsdadc dgaltlpefcaafhlivarkngyplpeglpptlqpefivtd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch