The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of archaeosine tRNA-guanine transglycosylase. J.Mol.Biol. 318 665-677 2002
    Site RSGI
    PDB Id 1iq8 Target Id trt001000215.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14108, Molecular Weight 66592.51 Da.
    Residues 582 Isoelectric Point 8.79
    Sequence msrgdkmlkfeikardgagrigklevngkkietpaimpvvnpkqmvvepkelekmgfeiiitnsyiiyk deelrrkalelgihrmldyngiievdsgsfqlmkygsievsnreiiefqhrigvdigtfldiptppdap reqavkeleitlsrareaeeikeipmnatiqgstytdlrryaarrlssmnfeihpiggvvpllesyrfr dvvdivisskmalrpdrpvhlfgaghpivfalavamgvdlfdsasyalyakddrymtpegtkrldeldy fpcscpvcskytpqelrempkeertrllalhnlwvikeeikrvkqaikegelwrlvderarshpklysa ykrllehytfleefepitkksalfkisneslrwpvvrrakeraksinerfgelvehpifgrvsrylslt ypfaqseaeddfkiekptkedaikyvmaiaeyqfgegasrafddakvelsktgmprqvkvngkrlatvr addglltlgiegakrlhrvlpyprmrvvvnkeaepfarkgkdvfakfvifadpgirpydevlvvnende llatgqallsgremivfqygravkvrkgve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.2610000
    Matthews' coefficent 3.36 Rfactor 0.2270000
    Waters 291 Solvent Content 63.37

    Ligand Information
    Metals MG (MAGNESIUM) x 2;ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch