.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ir6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of exonuclease RecJ bound to Mn2+ ion suggests how its characteristic motifs are involved in exonuclease activity. Proc.Natl.Acad.Sci.USA 99 5908-5912 2002
    Site RSGI
    PDB Id 1ir6 Target Id ttk003000716.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14415, Molecular Weight 72831.16 Da.
    Residues 666 Isoelectric Point 5.98
    Sequence mrdrvrwrvlslpplaqwrevmaalevgpeaalaywhrgfrrkedldpplallplkglreaaalleeal rqgkrirvhgdydadgltgtailvrglaalgadvhpfiphrleegygvlmervpehleasdlfltvdcg itnhaelrellengvevivtdhhtpgktpppglvvhpaltpdlkekptgagvaflllwalherlglppp leyadlaavgtiadvaplwgwnralvkeglaripasswvglrllaeavgytgkavevafriaprinaas rlgeaekalrllltddaaeaqalvgelhrlnarrqtleeamlrkllpqadpeakaivlldpeghpgvmg ivasrileatlrpvflvaqgkgtvrslapisavealrsaedlllrygghkeaagfamdealfpafkarv eayaarfpdpvrevalldllpepgllpqvfrelallepygegnpeplfllfgapeearrlgegrhlafr lkgvrvlawkqgdlalppevevagllsenawnghlayevqavdlrkpealeggiapfayplpllealar arlgegvyvpednpegldyarkagfrllppeeaglwlglpprpvlgrrvevalgreararlsappvlht pearlkalvhrrllfayerrhpglfseallaywevnrvqepagsp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.90 Rfree 0.2590000
    Matthews' coefficent Rfactor 0.2280000
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch