The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of a telomeric DNA complex of human TRF1. Structure 9 1237-1251 2001
    Site RSGI
    PDB Id 1ity Target Id my_001000018.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13681, Molecular Weight 8447.30 Da.
    Residues 69 Isoelectric Point 10.28
    Sequence tpekhrarkrqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkklklissdsed
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch