.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iuf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure determination of the two DNA-binding domains in the Schizosaccharomyces pombe Abp1 protein by a combination of dipolar coupling and diffusion anisotropy restraints. J.Biomol.NMR 22 333-347 2002
    Site RSGI
    PDB Id 1iuf Target Id my_001000008.1
    Molecular Characteristics
    Source Schizosaccharomyces pombe
    Alias Ids TPS13668, Molecular Weight 17056.57 Da.
    Residues 144 Isoelectric Point 9.62
    Sequence gihmgkikrraitehekralrhyffqlqnrsgqqdliewfrekfgkdisqpsvsqilsskysyldntve kpwdvkrnrppkyplleaalfewqvqqgddatlsgetikraaailwhkipeyqdqpvpnfsngwlegfr krhilh
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch