.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iug

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative aspartate aminotransferase belonging to subgroup IV. Proteins 55 487-492 2004
    Site RSGI
    PDB Id 1iug Target Id ttk003000402.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14362, Molecular Weight 37988.94 Da.
    Residues 352 Isoelectric Point 5.90
    Sequence mdwlltpgpvrlhpkalealarpqlhhrteaarevflkargllreafrtegevliltgsgtlamealvk nlfapgervlvpvygkfserfyeialeaglvverldypygdtprpedvakegyaglllvhsetstgala dlpalarafkeknpeglvgadmvtsllvgevaleamgvdaaasgsqkglmcppglgfvalspralerlk prgyyldlarelkaqkegesawtpainlvlavaavleevlprleehlalkawqnallygvgeegglrpv pkrfspavaafylpegvpyarvkeafaqrgaviaggqgplkgkvfrlslmgaydryealgvagmfrevl eeilpas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.236
    Matthews' coefficent 2.70 Rfactor 0.199
    Waters 192 Solvent Content 54.15

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch