.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iuh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the 2'-5' RNA Ligase from Thermus thermophilus HB8. J.MOL.BIOL. 329 903-911 2003
    Site RSGI
    PDB Id 1iuh Target Id ttk003000787.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14436, Molecular Weight 22409.74 Da.
    Residues 198 Isoelectric Point 9.25
    Sequence mrlfyavflpeevraalveaqtkvrpfrgwkpvpphqlhltllflgerpeeelpdylalghrlarleap frarlrgtgyfpnegtprvwfakaeaegflrlaeglragveellgeeavripgwdkpfkphitlarrka paprvppvlfglewpvegfalvrselkpkgpvytvlekfslrgehgreqaqgpgerpegd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.271
    Matthews' coefficent 2.56 Rfactor 0.198
    Waters 74 Solvent Content 51.91

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch