The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the conserved hypothetical protein TT1380 from Thermus thermophilus HB8. Proteins 55 778-780 2004
    Site RSGI
    PDB Id 1iuj Target Id ttk003001380.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14710, Molecular Weight 12256.31 Da.
    Residues 106 Isoelectric Point 5.48
    Sequence mfvtmnripvrpeyaeqfeeafrqrarlvdrmpgfirnlvlrpknpgdpyvvmtlweseeafrawtesp afkegharsgtlpkeaflgpnrleafevvldsegrdg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.26408
    Matthews' coefficent 1.65 Rfactor 0.23335
    Waters 61 Solvent Content 25.30

    Ligand Information
    Metals ZN (ZINC) x 7



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch