.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iv4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and catalytic mechanism of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate (MECDP) synthase, an enzyme in the non-mevalonate pathway of isoprenoid synthesis. Acta Crystallogr.,Sect.D 59 23-31 2003
    Site RSGI
    PDB Id 1iv4 Target Id ttk003001861.4
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14811, Molecular Weight 16519.08 Da.
    Residues 152 Isoelectric Point 6.97
    Sequence mrigygedshrleegrplylcgllipspvgalahsdgdaalhaltdallsayglgdigllfpdtdprwr gersevflrealrlveargakllqaslvltldrpklgphrkalvdslsrllrlpqdrigltfktsegla pshvqaravvlldg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.55 Rfree 0.257
    Matthews' coefficent 2.12 Rfactor 0.206
    Waters 516 Solvent Content 41.91

    Ligand Information
    Ligands C5P (CYTIDINE-5'-MONOPHOSPHATE) x 6
    Metals MG (MAGNESIUM) x 12

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch