The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Complex of Human Epidermal Growth Factor and Receptor Extracellular Domains. Cell(Cambridge,Mass.) 110 775-787 2002
    Site RSGI
    PDB Id 1ivo Target Id srz001000016.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14028, Molecular Weight 134284.21 Da.
    Residues 1210 Isoelectric Point 6.31
    Sequence mrpsgtagaallallaalcpasraleekkvcqgtsnkltqlgtfedhflslqrmfnncevvlgnleity vqrnydlsflktiqevagyvlialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmr nlqeilhgavrfsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgscqkcdpscpngscwgageenc qkltkiicaqqcsgrcrgkspsdcchnqcaagctgpresdclvcrkfrdeatckdtcpplmlynpttyq mdvnpegkysfgatcvkkcprnyvvtdhgscvracgadsyemeedgvrkckkcegpcrkvcngigigef kdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldilktvkeitgflliqawpenr tdlhafenleiirgrtkqhgqfslavvslnitslglrslkeisdgdviisgnknlcyantinwkklfgt sgqktkiisnrgensckatgqvchalcspegcwgpeprdcvscrnvsrgrecvdkckllegeprefven seciqchpeclpqamnitctgrgpdnciqcahyidgphcvktcpagvmgenntlvwkyadaghvchlch pnctygctgpglegcptngpkipsiatgmvgalllllvvalgiglfmrrrhivrkrtlrrllqerelve pltpsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankei ldeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqiakgmnyl edrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikwmalesilhriythqsdv wsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmidadsrpkfrelii efskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdadeylipqqgffsspstsrtpll sslsatsnnstvacidrnglqscpikedsflqryssdptgaltedsiddtflpvpeyinqsvpkrpags vqnpvyhnqplnpapsrdphyqdphstavgnpeylntvqptcvnstfdspahwaqkgshqisldnpdyq qdffpkeakpngifkgstaenaeylrvapqssefiga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.30 Rfree 0.326
    Matthews' coefficent Rfactor 0.255
    Waters 79 Solvent Content

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch