.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iw0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structures of the ferric and ferrous forms of the heme complex of HmuO, a heme oxygenase of Corynebacterium diphtheriae. J.Biol.Chem. 279 11937-11947 2004
    Site RSGI
    PDB Id 1iw0 Target Id my_001000032.1
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS13706, Molecular Weight 24136.89 Da.
    Residues 215 Isoelectric Point 5.38
    Sequence mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavrasgfa eslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalvahhyvrylgdls ggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlelsdeqrehllkeatdafvfnhqv fadlgkgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.40 Rfree 0.19187
    Matthews' coefficent 2.18 Rfactor 0.16541
    Waters 657 Solvent Content 43.05

    Ligand Information
    Ligands HEM (PROTOPORPHYRIN) x 3;SUC (SUCROSE) x 1;SO4 (SULFATE) x 6
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch