.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iwi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Infrared spectroscopic and mutational studies on putidaredoxin-induced conformational changes in ferrous CO-P450cam. Biochemistry 42 14507-14514 2003
    Site RSGI
    PDB Id 1iwi Target Id my_001000033.1
    Molecular Characteristics
    Source Pseudomonas putida
    Alias Ids TPS13708, Molecular Weight 46666.73 Da.
    Residues 415 Isoelectric Point 5.24
    Sequence mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg qlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenriqelacs lieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsmtfaeakealydylip iieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldtvvnflsfsmeflakspehrqeli erperipaaceellrrfslvadgriltsdyefhgvqlkkgdqillpqmlsglderenacpmhvdfsrqk vshttfghgshlclgqhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.182
    Matthews' coefficent 2.20 Rfactor 0.177
    Waters 126 Solvent Content 44.18

    Ligand Information
    Ligands HEM (PROTOPORPHYRIN) x 1;CAM (CAMPHOR) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch