.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iwq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a MARCKS peptide containing the calmodulin-binding domain in complex with Ca(2+)-calmodulin. NAT.STRUCT.BIOL. 10 226-231 2003
    Site RSGI
    PDB Id 1iwq Target Id my_001000043.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13722, Molecular Weight 16705.54 Da.
    Residues 148 Isoelectric Point 4.09
    Sequence adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtidfpefl tmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvny eefvqmmtak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.26686
    Matthews' coefficent 2.10 Rfactor 0.22308
    Waters 86 Solvent Content 41.57

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch