.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ixd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The CAP-Gly domain of CYLD associates with the proline-rich sequence in NEMO/IKKgamma. STRUCTURE 12 1719-1728 2004
    Site RSGI
    PDB Id 1ixd Target Id hsk001000012.3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12565, Molecular Weight 9867.81 Da.
    Residues 91 Isoelectric Point 6.76
    Sequence lamppgnshglevgslaevkenppfygvirwigqppglnevlagleledecagctdgtfrgtryftcal kkalfvklkscrpdsrfaslqp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch