The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Specific Damage Induced by X-ray Radiation and Structural Changes in the Primary Photoreaction of Bacteriorhodopsin. J.MOL.BIOL. 324 469-481 2002
    Site RSGI
    PDB Id 1ixf Target Id my_001000028.2
    Molecular Characteristics
    Source Halobacterium salinarum
    Alias Ids TPS13699, Molecular Weight 26799.05 Da.
    Residues 248 Isoelectric Point 4.83
    Sequence qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgygltmv pfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvgaltkvysyrfvww aistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsaypvvwligsegagivplnietll fmvldvsakvgfglillrsraifgeaeapepsagdgaaats
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.321
    Matthews' coefficent 3.16 Rfactor 0.291
    Waters 41 Solvent Content 61.10

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch