The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the Dff-C Domain of Dff45/Icad. A Structural Basis for the Regulation of Apoptotic DNA Fragmentation. J.Mol.Biol. 321 317-327 2002
    Site RSGI
    PDB Id 1iyr Target Id srz001000055.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS14030, Molecular Weight 36558.02 Da.
    Residues 331 Isoelectric Point 4.80
    Sequence melsrgasapdpddvrplkpcllrrnhsrdqhgvaassleelrskacellaidksltpitlvlaedgti vddddyflclpsntkfvalacnekwtyndsdggtawvsqesfeadepdsragvkwknvarqlkedlssi illseedlqalidipcaelaqelcqscatvqglqstlqqvldqreearqskqllelylqalekegnils nqkeskaalseeldavdtgvgremasevllrsqilttlkekpapelslssqdlesvskedpkalavals wdirkaetvqqacttelalrlqqvqslhslrnlsarrsplpgepqrpkrakrdss
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch