.
The Open Protein Structure Annotation Network
PDB Keyword
.

1iyw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Mechanism of molecular interactions for tRNA(Val) recognition by valyl-tRNA synthetase. RNA 9 100-111 2003
    Site RSGI
    PDB Id 1iyw Target Id trt001000468.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14142, Molecular Weight 98770.03 Da.
    Residues 862 Isoelectric Point 5.84
    Sequence mdlpkaydpksvepkwaekwaknpfvanpksgkppfvifmpppnvtgslhmghaldnslqdalirykrm rgfeavwlpgtdhagiatqvvverlllkegktrhdlgrekflervwqwkeesggtilkqlkrlgasadw sreaftmdekrsravryafsryyheglayraprlvnwcprcettlsdleveteptpgklytlryevegg gfieiatvrpetvfadqaiavhpederyrhllgkraripltevwipiladpavekdfgtgalkvtpahd pldyeigerhglkpvsvinlegrmegervpealrgldrfearrkavelfreaghlvkeedytialatcs rcgtpieyaifpqwwlrmrplaeevlkglrrgdiafvperwkkvnmdwlenvkdwnisrqlwwghqipa wycedcqavnvprperyledptsceacgsprlkrdedvfdtwfssalwplstlgwpeetedlkafypgd vlvtgydilflwvsrmevsgyhfmgerpfktvllhglvldekgqkmskskgnvidplemverygadalr faliylatggqdirldlrwlemarnfanklynaarfvllsregfqakedtptladrfmrsrlsrgveei talyealdlaqaarevyelvwsefcdwyleaakpalkagnahtlrtleevlavllkllhpmmpfltsel yqaltgkeelaleawpepggrdeeaerafealkqavtavralkaeaglppaqevrvylegetapveenl evfrflsradllperpakalvkamprvtarmpleglldveewrrrqekrlkellalaersqrklaspgf rekapkevveaeearlkenleqaerirealsqig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 4.00 Rfree 0.3828
    Matthews' coefficent 2.89 Rfactor 0.3164
    Waters Solvent Content 57.50

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch