The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of the Quinone Oxidoreductase from Thermus thermophilus HB8 and Its Complex with NADPH: Implication for NADPH and Substrate Recognition. J.Bacteriol. 185 4211-4218 2003
    Site RSGI
    PDB Id 1iyz Target Id ttk003000390.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14358, Molecular Weight 32086.89 Da.
    Residues 302 Isoelectric Point 6.49
    Sequence mkawvlkrlggplelvdlpepeaeegevvlrveavglnfadhlmrlgayltrlhppfipgmevvgvveg rryaalvpqgglaervavpkgallplpeglspeeaaafpvsfltaylalkraqarpgekvlvqaaagal gtaavqvaramglrvlaaasrpeklalplalgaeeaatyaevperakawggldlvlevrgkeveeslgl lahggrlvyigaaegevapipplrlmrrnlavlgfwltpllregalveealgfllprlgrelrpvvgpv fpfaeaeaafralldrghtgkvvvrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.256
    Matthews' coefficent 3.31 Rfactor 0.219
    Waters 36 Solvent Content 62.56

    Ligand Information
    Ligands NDP (NADPH) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch