The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Malate Dehydrogenase from Thermus themrophilus HB8. To be published
    Site RSGI
    PDB Id 1iz9 Target Id ttk003000544.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14413, Molecular Weight 35423.92 Da.
    Residues 327 Isoelectric Point 5.74
    Sequence mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledcafpllagle atddpkvafkdadyallvgaaprkagmerrdllqvngkifteqgralaevakkdvkvlvvgnpantnal iayknapglnprnftamtrldhnrakaqlakktgtgvdrirrmtvwgnhsstmfpdlfhaevdgrpale lvdmewyekvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygipe givysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.2260000
    Matthews' coefficent 2.64 Rfactor 0.1930000
    Waters 152 Solvent Content 53.35

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch