.
The Open Protein Structure Annotation Network
PDB Keyword
.

1izo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Substrate Recognition and Molecular Mechanism of Fatty Acid Hydroxylation by Cytochrome P450 from Bacillus subtilis. CRYSTALLOGRAPHIC, SPECTROSCOPIC, AND MUTATIONAL STUDIES. J.Biol.Chem. 278 9761-9767 2003
    Site RSGI
    PDB Id 1izo Target Id my_001000031.1
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS13705, Molecular Weight 48106.62 Da.
    Residues 417 Isoelectric Point 6.45
    Sequence mneqiphdksldnsltllkegylfiknrterynsdlfqarllgknficmtgaeaakvfydtdrfqrqna lpkrvqkslfgvnaiqgmdgsahihrkmlflslmtpphqkrlaelmteewkaavtrwekadevvlfeea keilcrvacywagvplketevkeraddfidmvdafgavgprhwkgrrarpraeewievmiedaragllk ttsgtalhemafhtqedgsqldsrmaaielinvlrpivaisyflvfsalalhehpkykewlrsgnsrer emfvqevrryypfgpflgalvkkdfvwnncefkkgtsvlldlygtnhdprlwdhpdefrperfaereen lfdmipqggghaekghrcpgegitievmkasldflvhqieydvpeqslhyslarmpslpesgfvmsgirrks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.10 Rfree 0.28
    Matthews' coefficent 2.67 Rfactor 0.246
    Waters 295 Solvent Content 53.54

    Ligand Information
    Ligands HEM (PROTOPORPHYRIN) x 3;PAM (PALMITOLEIC) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch