.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j0g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of Mouse Hypothetical 9.1 kDa Protein, A Ubiquitin-like Fold. To be Published
    Site RSGI
    PDB Id 1j0g Target Id mmk001005942.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13458, Molecular Weight 9117.05 Da.
    Residues 85 Isoelectric Point 9.36
    Sequence mskvsfkitltsdprlpykvlsvpestpftavlkfaaeefkvpaatsaiitndgiginpaqtagnvflk hgselriiprdrvgsc
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch