.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j1h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of a tmRNA-binding protein, SmpB, from Thermus thermophilus. FEBS Lett. 535 94-100 2003
    Site RSGI
    PDB Id 1j1h Target Id ttk003000801.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14441, Molecular Weight 16749.54 Da.
    Residues 144 Isoelectric Point 9.74
    Sequence mapvlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyiapyekgsya nvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglargkkayekrredkkeavr raleel
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch