.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j20

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of argininosuccinate synthetase in enzyme-ATP-substrates and enzyme-AMP-product forms. J.Biol.Chem. 278 22964-22971 2003
    Site RSGI
    PDB Id 1j20 Target Id ttk003000039.6
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14198, Molecular Weight 44813.73 Da.
    Residues 400 Isoelectric Point 5.65
    Sequence mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaialdlkeefvrdf vfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgndqvrfeltayalkpdikv iapwrewsfqgrkemiayaeahgipvpvtqekpysmdanllhisyeggvledpwaeppkgmfrmtqdpe eapdapeyveveffegdpvavngerlspaallqrlneiggrhgvgrvdivenrfvgmksrgvyetpggt ilyharravesltldrevlhqrdmlspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgn vyvvgrkapkslyrqdlvsfdeaggydqkdaegfikiqalrlrvralvereghga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.239
    Matthews' coefficent 4.31 Rfactor 0.212
    Waters 862 Solvent Content 71.21

    Ligand Information
    Ligands SO4 (SULFATE) x 4;AMP (ADENOSINE) x 4;AS1 (ARGININOSUCCINATE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch