.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j27

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein, TT1725, from Thermus thermophilus HB8 at 1.7 A resolution. Proteins 53 768-771 2003
    Site RSGI
    PDB Id 1j27 Target Id ttk003001725.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14785, Molecular Weight 11406.59 Da.
    Residues 102 Isoelectric Point 6.31
    Sequence mkaylglytarletparslkekralikpalerlkarfpvsaarlygldawgyevvgftllgndpawvee tmraaarflaeaggfqvaleefrleafeldgll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.218
    Matthews' coefficent 2.75 Rfactor 0.178
    Waters 129 Solvent Content 55.33

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch