.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j2b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Alternative Tertiary Structure of tRNA for Recognition by a Posttranscriptional Modification Enzyme. Cell(Cambridge,Mass.) 113 383-394 2003
    Site RSGI
    PDB Id 1j2b Target Id trt001000258.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14118, Molecular Weight 66592.51 Da.
    Residues 582 Isoelectric Point 8.79
    Sequence msrgdkmlkfeikardgagrigklevngkkietpaimpvvnpkqmvvepkelekmgfeiiitnsyiiyk deelrrkalelgihrmldyngiievdsgsfqlmkygsievsnreiiefqhrigvdigtfldiptppdap reqavkeleitlsrareaeeikeipmnatiqgstytdlrryaarrlssmnfeihpiggvvpllesyrfr dvvdivisskmalrpdrpvhlfgaghpivfalavamgvdlfdsasyalyakddrymtpegtkrldeldy fpcscpvcskytpqelrempkeertrllalhnlwvikeeikrvkqaikegelwrlvderarshpklysa ykrllehytfleefepitkksalfkisneslrwpvvrrakeraksinerfgelvehpifgrvsrylslt ypfaqseaeddfkiekptkedaikyvmaiaeyqfgegasrafddakvelsktgmprqvkvngkrlatvr addglltlgiegakrlhrvlpyprmrvvvnkeaepfarkgkdvfakfvifadpgirpydevlvvnende llatgqallsgremivfqygravkvrkgve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.30 Rfree 0.288
    Matthews' coefficent 3.95 Rfactor 0.225
    Waters 41 Solvent Content 68.58

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 4;ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch