The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and biochemical analyses of hemimethylated DNA binding by the SeqA protein. Nucleic Acids Res. 32 82-92 2004
    Site RSGI
    PDB Id 1j3e Target Id trt001000146.2
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS14086, Molecular Weight 12963.22 Da.
    Residues 115 Isoelectric Point 7.32
    Sequence plgsamrelllsdeyaeqkravnrfmlllstlysldaqafaeateslhgrtrvyfaadeqtllkngnqt kpkhvpgtpywvitntntgrkcsmiehimqsmqfpaeliekvcgti
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.296
    Matthews' coefficent 2.18 Rfactor 0.2302
    Waters 84 Solvent Content 43.06

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch