.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j3m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a conserved hypothetical protein TT1751 from Thermus thermophilus HB8. Proteins 57 883-887 2004
    Site RSGI
    PDB Id 1j3m Target Id ttk003001751.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14787, Molecular Weight 13955.59 Da.
    Residues 129 Isoelectric Point 5.63
    Sequence mtgmrktlkatlaearaqveaalkeegfgilteidvaatlkaklglekppylilgacnpnlaaraleal peiglllpcnvvlreaeegvevliqdpkemfrvlpeatqralapvaeeartrlsralsrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.25884
    Matthews' coefficent 2.34 Rfactor 0.19365
    Waters 112 Solvent Content 47.51

    Ligand Information
    Ligands SO3 (SULFITE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch