.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j3w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Gliding protein-mglB from Thermus THermophilus HB8. To be Published
    Site RSGI
    PDB Id 1j3w Target Id ttk003001195.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14532, Molecular Weight 17801.41 Da.
    Residues 163 Isoelectric Point 4.98
    Sequence mvepslvlygapyeravevleetlretgaryallidrkgfvlahkealwapkpppldtlvtlvagnaaa tqalakllgearfqeevhqgermglyvdeagehallvlvfdetaplgkvklhgkraaealariaeeala npprlaldteyregaeallddllrn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.50 Rfree 0.2225
    Matthews' coefficent 2.49 Rfactor 0.2076
    Waters 553 Solvent Content 50.25

    Ligand Information
    Ligands SO4 (SULFATE) x 2;MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 2
    Metals MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch