The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Direct observation of photolysis-induced tertiary structural changes in hemoglobin. Proc.Natl.Acad.Sci.USA 100 7039-7044 2003
    Site RSGI
    PDB Id 1j3y Target Id my_001000029.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13702, Molecular Weight 15125.51 Da.
    Residues 141 Isoelectric Point 8.73
    Sequence vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgkkvadaltna vahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpavhasldkflasvstvlts kyr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.55 Rfree 0.205
    Matthews' coefficent 2.39 Rfactor 0.162
    Waters 2272 Solvent Content 48.60

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch