.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j3z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Direct observation of photolysis-induced tertiary structural changes in hemoglobin. Proc.Natl.Acad.Sci.USA 100 7039-7044 2003
    Site RSGI
    PDB Id 1j3z Target Id my_001000029.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13701, Molecular Weight 15125.51 Da.
    Residues 141 Isoelectric Point 8.73
    Sequence vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgkkvadaltna vahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpavhasldkflasvstvlts kyr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.60 Rfree 0.196
    Matthews' coefficent 2.35 Rfactor 0.159
    Waters 1335 Solvent Content 47.70

    Ligand Information
    Ligands HEM-CMO (PROTOPORPHYRIN) x 4;HNI (CARBON) x 4;2FU (PROTOPORPHYRIN) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch