.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jfc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of nitric oxide reductase (cytochrome P450nor) at atomic resolution. Acta Crystallogr.,Sect.D 58 81-89 2002
    Site RSGI
    PDB Id 1jfc Target Id my_001000027.2
    Molecular Characteristics
    Source Fusarium oxysporum
    Alias Ids TPS13697, Molecular Weight 44470.55 Da.
    Residues 404 Isoelectric Point 5.75
    Sequence tmasgapsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvrtrqg fpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddlleqmkqkgcangp vdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstareasaanqelldylailveqrlvep kddiisklcteqvkpgnidksdavqiaflllvagnatmvnmialgvatlaqhpdqlaqlkanpslapqf veelcryhtasalaikrtakedvmigdklvranegiiasnqsanrdeevfenpdefnmnrkwppqdplg fgfgdhrciaehlakaelttvfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.05 Rfree 0.1520000
    Matthews' coefficent 2.17 Rfactor 0.1170000
    Waters 892 Solvent Content 43.38

    Ligand Information
    Ligands HEM-CMO (PROTOPORPHYRIN) x 1;GOL (CARBON) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch