The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Imidazole Glycerol Phosphate Synthase from Thermus thermophilus HB8: Open-Closed Conformational Change and Ammonia Tunneling. J.BIOCHEM.(TOKYO) 132 759-765 2002
    Site RSGI
    PDB Id 1ka9 Target Id ttk003000060.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14210, Molecular Weight 26950.46 Da.
    Residues 252 Isoelectric Point 5.79
    Sequence mslakrivpcldvhagrvvkgvnfvnlrdagdpveaaraydeagadelvfldisatheerailldvvar vaervfipltvgggvrsledarklllsgadkvsvnsaavrrpelireladhfgaqavvlaidarwrgdf pevhvaggrvptglhavewavkgvelgageilltsmdrdgtkegydlrltrmvaeavgvpviasggagr mehfleafqagaeaalaasvfhfgeipipklkrylaekgvhvrld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.256
    Matthews' coefficent 2.70 Rfactor 0.203
    Waters 118 Solvent Content 54.51

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch