.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kor

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of argininosuccinate synthetase from Thermus thermophilus HB8. Structural basis for the catalytic action. J.Biol.Chem. 277 15890-15896 2002
    Site RSGI
    PDB Id 1kor Target Id ttk003000039.4
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14196, Molecular Weight 44813.73 Da.
    Residues 400 Isoelectric Point 5.65
    Sequence mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaialdlkeefvrdf vfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgndqvrfeltayalkpdikv iapwrewsfqgrkemiayaeahgipvpvtqekpysmdanllhisyeggvledpwaeppkgmfrmtqdpe eapdapeyveveffegdpvavngerlspaallqrlneiggrhgvgrvdivenrfvgmksrgvyetpggt ilyharravesltldrevlhqrdmlspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgn vyvvgrkapkslyrqdlvsfdeaggydqkdaegfikiqalrlrvralvereghga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.25
    Matthews' coefficent 4.53 Rfactor 0.23
    Waters 799 Solvent Content 72.84

    Ligand Information
    Ligands ANP (PHOSPHOAMINOPHOSPHONIC) x 4;ARG (SUCCINIC) x 4;SIN x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch