The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The First Crystal Structure of Archaeal Aldolase. UNIQUE TETRAMERIC STRUCTURE of 2-DEOXY-D-RIBOSE-5-PHOSPHATE ALDOLASE FROM THE HYPERTHERMOPHILIC ARCHAEA Aeropyrum pernix. J.Biol.Chem. 278 10799-10806 2003
    Site RSGI
    PDB Id 1n7k Target Id my_001000144.1
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS13747, Molecular Weight 24396.76 Da.
    Residues 234 Isoelectric Point 6.00
    Sequence psardilqqgldrlgspedlasridstllsprateedvrnlvreasdygfrcavltpvytvkisglaek lgvklcsvigfplgqaplevklveaqtvleagateldvvphlslgpeavyrevsgivklaksygavvkv ileaplwddktlsllvdssrragadivktstgvytkggdpvtvfrlaslakplgmgvkasggirsgida vlavgagadiigtssavkvlesfkslv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.263
    Matthews' coefficent 2.83 Rfactor 0.224
    Waters 199 Solvent Content 56.52

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch