.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nz8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and sequence comparisons arising from the solution structure of the transcription elongation factor NusG from Thermus thermophilus. Proteins 56 40-51 2004
    Site RSGI
    PDB Id 1nz8 Target Id ttk003000790.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14439, Molecular Weight 13429.88 Da.
    Residues 120 Isoelectric Point 5.11
    Sequence msiewyavhtlvgqeekakanlekrikafglqdkifqvlipteevvelreggkkevvrkklfpgylfiq mdlgdeeepneawevvrgtpgitgfvgagmrpvplspdevrhilevsgllg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch