.
The Open Protein Structure Annotation Network
PDB Keyword
.

1od6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and Implications for the Thermal Stability of Phosphopantetheine Adenylyltransferase from Thermus Thermophilus. Acta Crystallogr.,Sect.D 60 97 2004
    Site RSGI
    PDB Id 1od6 Target Id ttk003000265.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14315, Molecular Weight 17706.53 Da.
    Residues 160 Isoelectric Point 9.43
    Sequence mhvvypgsfdpltnghldviqrasrlfekvtvavlenpskrgqylfsaeerlaiireatahlanveaat fsgllvdfvrrvgaqaivkglravsdyeyelqmahlnrqlypgletlfilaatrysfvsstmvkeiary ggdvsklvppatlralkaklgq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.5 Rfree 0.201
    Matthews' coefficent 4.2 Rfactor 0.196
    Waters 162 Solvent Content 70

    Ligand Information
    Ligands PNS (4'-PHOSPHOPANTETHEINE) x 1;SO4 (SULFATE) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch