The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Purine Nucleoside Phosphorylase from Thermus Thermophilus. J.Mol.Biol. 337 1149 2004
    Site RSGI
    PDB Id 1odk Target Id ttk003000127.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14235, Molecular Weight 25413.76 Da.
    Residues 235 Isoelectric Point 6.13
    Sequence mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvqttgmgtps aaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqylegrpyapvpdpevfralw rraealgyphrvglvasedafyattpeearawarygvlafemeasalfllgrmrgvrtgailavsnrig dpelappevlqegvrrmvevaleavlev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.9 Rfree 0.208
    Matthews' coefficent 2.5 Rfactor 0.180
    Waters 766 Solvent Content 49.9

    Ligand Information
    Ligands GOL (GLYCEROL) x 6



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch