.
The Open Protein Structure Annotation Network
PDB Keyword
.

1oi7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of Succinyl-Coa Synthetase from Thermus Thermophilus. To be Published
    Site RSGI
    PDB Id 1oi7 Target Id ttk003000542.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14411, Molecular Weight 29882.99 Da.
    Residues 288 Isoelectric Point 5.56
    Sequence milvnretrvlvqgitgregqfhtkqmlsygtkivagvtpgkggmevlgvpvydtvkeavahhevdasi ifvpapaaadaaleaahagiplivlitegiptldmvraveeikalgsrliggncpgiisaeetkigimp ghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggdpvigttfkdllplfnedpeteavvlig eiggfdeeeaaawvkdhmkkpvvgfiggrsapkgkrmghagaiimgnvgtpesklrafaeagipvadti deivelvkkalg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.23 Rfree 0.196
    Matthews' coefficent 2.3 Rfactor 0.178
    Waters 419 Solvent Content 43.5

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch