The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of the pleckstrin homology domain of mouse Son-of-sevenless 1 (mSos1). J.Mol.Biol. 269 579-591 1997
    Site RSGI
    PDB Id 1pms Target Id my_001000016.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13679, Molecular Weight 15546.04 Da.
    Residues 136 Isoelectric Point 8.67
    Sequence gskqlaikkmneiqknidgwegkdigqccnefimegtltrvgakherhiflfdglmiccksnhgqprlp gassaeyrlkekffmrkvqindkddtseykhafeiilkdgnsvifsaksaeeknnwmaalislqyrs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch