.
The Open Protein Structure Annotation Network
PDB Keyword
.

1r79

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of The C1 Domain of The Human Diacylglycerol Kinase Delta. To be Published
    Site RSGI
    PDB Id 1r79 Target Id hsk002000142.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12573, Molecular Weight 7823.73 Da.
    Residues 71 Isoelectric Point 6.61
    Sequence ttlasigkdiiedadgiamphqwlegnlpvsakctvcdktcgsvlrlqdwrclwckamvhtsckesllt kc
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch