.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tuo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative phosphomannomutase from Thermus Thermophilus HB8. TO BE PUBLISHED
    Site RSGI
    PDB Id 1tuo Target Id ttk003000515.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14401, Molecular Weight 50243.18 Da.
    Residues 464 Isoelectric Point 6.13
    Sequence mcyasmemsapirfgtegfrgviareftfatlhrlaeaygrhllerggglvvvghdtrfladafarals ghlagmglkvvllkgpvptpllsfavrhlkaaggamltashnppqylgvkfkdatggpiaqeeakaiea lvpeearalegayetldlreayfealkahldlkalsgfsgvlyhdsmggagagflkgflrhvgleipvr pireephplfhgvnpepipknlgvtlavlgpetppsfavatdgdadrvgvvlpggvffnphqvlttlal yrfrkghrgravknfavtwlldrlgerlgfgvtttpvgfkwikeeflkgdcfiggeesggvgypehlpe rdgiltsllllesvaatgkdlaeqfkevealtglthaydrldlplkapldltpfreprplagltpkgvd tldgvkwlyeeawvlfrasgtepvvriyveaqspelvralleearklveg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.247
    Matthews' coefficent 2.20 Rfactor 0.221
    Waters 280 Solvent Content 43.60

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch