The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the conserved protein TT1542 from Thermus thermophilus HB8. PROTEIN SCI. 12 1621-1632 2003
    Site RSGI
    PDB Id 1uan Target Id ttk003001542.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14738, Molecular Weight 24785.95 Da.
    Residues 227 Isoelectric Point 6.54
    Sequence mldllvvaphpddgelgcggtlarakaeglstgildltrgemgskgtpeerekevaeasrilgldfrgn lgfpdggladvpeqrlklaqalrrlrprvvfapleadrhpdhtaasrlavaavhlaglrkaplegepfr verlffypgnhpfapsflvkisafidqweaavlayrsqftgeaasetvgpkgvearkamrrywgnylgv dyaepfvsplpvlyvpwsra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.24258
    Matthews' coefficent 3.29 Rfactor 0.20085
    Waters 156 Solvent Content 62.60

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch