.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ub3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of aldolase from Thermus thermophilus HB8 showing the contribution of oligomeric state to thermostability. Acta Crystallogr.,Sect.D 60 1816-1823 2004
    Site RSGI
    PDB Id 1ub3 Target Id ttk003000501.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14391, Molecular Weight 23305.43 Da.
    Residues 220 Isoelectric Point 5.87
    Sequence mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtvvgfplgyqe kevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqavlkviletgyfspeeiarl aeaairggadflktstgfgprgasledvallvrvaqgraqvkaaggirdretalrmlkagasrlgtssg valvageggtlgy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.40 Rfree 0.211
    Matthews' coefficent 2.23 Rfactor 0.202
    Waters 442 Solvent Content 44.52

    Ligand Information
    Ligands HPD (1-HYDROXY-PENTANE-3,4-DIOL-5-PHOSPHATE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch