The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of Beta-Ketoacyl-[Acyl Carrier Protein] Synthase III (Fabh) from Thermus Thermophilus. To be Published
    Site RSGI
    PDB Id 1ub7 Target Id ttk003000138.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14244, Molecular Weight 34529.48 Da.
    Residues 322 Isoelectric Point 5.38
    Sequence msgilalgayvpervmtnadfeayldtsdewivtrtgikerrvaaedeytsdlafkavedllrrhpgal egvdavivatntpdalfpdtaalvqarfglkafaydllagcpgwiyalaqahalveaglaqkvlavgae alskiidwndratavlfgdgggaavvgkvregygfrsfvlgadgtgakelyhacvaprlpdgtsmknrl ymngrevfkfavrvmntatleaiekagltpedirlfvphqanlriidaarerlglpwervavnvdrygn tstasiplalkealdagriregdhvllvsfgagltwaaavltwgga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.241
    Matthews' coefficent 2.80 Rfactor 0.193
    Waters 327 Solvent Content 56.00

    Ligand Information
    Ligands GOL (GLYCEROL) x 10



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch