.
The Open Protein Structure Annotation Network
PDB Keyword
.

1udn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the tRNA Processing Enzyme RNase PH from Aquifex aeolicus. J.Biol.Chem. 278 32397-32404 2003
    Site RSGI
    PDB Id 1udn Target Id trt001000260.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS14121, Molecular Weight 28370.96 Da.
    Residues 255 Isoelectric Point 5.45
    Sequence mrsdgrkedqlrpvsiqrdfleypegsclisfgktkvictasvienvpnwlkgkgqgwitaeysmlpra tqqrtiresvqgriggrtheiqrmigramrtaveltkigertiwvdcdviqadggtrtaaitgafvava daiiklhkegiieetpikdfvaavsvgivndrilldlnfeedsaaqvdmnvvgtgsgrlsevhtmgeey sftkdelikmldlaqkginelielqkklyviqdgkwerselkevsstt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.275
    Matthews' coefficent 4.43 Rfactor 0.233
    Waters 100 Solvent Content 72.25

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;SO4 (SULFATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch