.
The Open Protein Structure Annotation Network
PDB Keyword
.

1udx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the GTP-binding protein Obg from Thermus thermophilus HB8. J.Mol.Biol. 337 761-770 2004
    Site RSGI
    PDB Id 1udx Target Id ttk003001381.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14711, Molecular Weight 44457.52 Da.
    Residues 416 Isoelectric Point 6.66
    Sequence mfqdvlvitvavgrggdgavsfrrekfvpkggpdggdggrggsvylrargsvdslsrlskrtykaedge hgrgsqqhgrggedlvievprgtrvfdadtgelladlteegqtvlvarggaggrgnmhfvsptrqaprf aeageegekrrlrlelmliadvglvgypnagkssllaamtrahpkiapypfttlspnlgvvevseeerf tladipgiiegasegkglgleflrhiagtrvllyvldaaddpfktlktlrkkvwaydpgllgrpslval nkvdllekeavkaladalareglavlpvsaltgaglpalkealhalvrstpppempkpvprkevqagve vvpvaegvyevrapeverylarikgdlmeaagylqevfrrqgveaalrakgvragdlvrigglefeyipev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.07 Rfree 0.278
    Matthews' coefficent 2.79 Rfactor 0.226
    Waters 165 Solvent Content 55.87

    Ligand Information
    Ligands ACT (ACETATE) x 2;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch