The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of the CP1 domain from Thermus thermophilus isoleucyl-tRNA synthetase and its complex with L-valine. J.Biol.Chem. 279 8396-8402 2004
    Site RSGI
    PDB Id 1ue0 Target Id ttk003000883.4
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14475, Molecular Weight 20387.33 Da.
    Residues 184 Isoelectric Point 5.31
    Sequence qdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealileeglgrkll gegtpvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhqapafgaedletarvyglp llktvdeegkllvepfkglyfreanrailrdlrgrgllfkeesylh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.249
    Matthews' coefficent 2.61 Rfactor 0.203
    Waters 166 Solvent Content 52.53

    Ligand Information
    Ligands VAL x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch